Bacterial taxon 1392858
Locus CO715_06050
Protein ATI05318.1
hypothetical protein
Escherichia coli M12
Length 371 aa, Gene n/a, UniProt n/a
>ATI05318.1|Escherichia coli M12|hypothetical protein
MVTPVSISNYISLPDDFPVRNIAPQVKEVLKDFIDALSTIICDEEWRTSLNINSATKKIFNNLDNLSYIQRTSFRGNDTLYNEKVQFKLTYPVKNGRHKENIEFQVVINLSPIYLDNFRHDGEINIFCAPNPKPVTMGRVFQTGVERVLFLFLNDFIEQFPIINPGVPIKRAHTPHIEPLHPDHHTAADYLRQFDLLVLNFISRGNFVILPRLWNNSEVHRWFGNKEPNLLTAILDITDSELKEDLLQSLMDSLGSNKHVLPEVCICFLSLLAEQDFPHFQDLFLFFANMLLHYHQFMNPNESDLIDVLMPASLSDDKIIKHMARKTLKLFVKNETPPKVTHEDLVKNRPRSPVRPPIPATSKTPDLPERH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.21 | 1.8e-57 | ●○○○○ -0.96 | -0.9590552162732989 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.8 | 7.7e-28 | ●○○○○ -0.25 | -0.24611178558493998 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)