Bacterial taxon 1392858
Locus CO715_06185
Protein ATI05343.1
hypothetical protein
Escherichia coli M12
Length 156 aa, Gene n/a, UniProt n/a
>ATI05343.1|Escherichia coli M12|hypothetical protein
MRLSRHLSLATGGKPSLMVIILTDSLLSRFNKLNVPLYLHPGLPLKSVQQAYFTGFSAEVNSRLSMFAWGWHHEAGIHLLRLMLSGAFDKYPHLQVISGHWGEMLPFWLQRLDDSLPLAATGLSRTLTRTFQEHVYVTPSYANTAALPVYLRVNGC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.88 | 2.2e-18 | ●●○○○ -1.72 | -1.72290827443838 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.5 | 0.0035 | ●●○○○ -1.02 | -1.017893392291478 | 29101196 |
Retrieved 2 of 2 entries in 2.2 ms
(Link to these results)