Bacterial taxon 1392858
Locus CO715_06300
Protein ATI05363.1
hypothetical protein
Escherichia coli M12
Length 98 aa, Gene n/a, UniProt n/a
>ATI05363.1|Escherichia coli M12|hypothetical protein
MLYVIYAQDKADSLEKRLSVRPAHLARLQLLHDEGRLLTAGPMPAVDSNDPGAAGFTGSTVIAEFESLEAAQAWADADPYVAAGVYEHVSVKPFKKVF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.61 | 1.2e-47 | ●●○○○ -1.04 | -1.0425136219728433 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.67 | 1.6e-11 | ○○○○○ 1.1 | 1.102993342548197 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)