Bacterial taxon 1392858
Locus CO715_06395
Protein ATI05381.1
hypothetical protein
Escherichia coli M12
Length 152 aa, Gene n/a, UniProt n/a
>ATI05381.1|Escherichia coli M12|hypothetical protein
MSQLCPCGSAVEYSLCCHPYVSGEKVAPDPEHLMRSRYCAFVMKDADYLIKTWHPSCGAAALRAELIAGFAHTEWLGLTVFEHCWQDVDNIGFVSFVARFTEGGKTGAIIERSRFLKENGQWYYIDGTRPQFGRNDPCPCGSGKKFKKCCGQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.64 | 0.0042 | ○○○○○ 0.89 | 0.8885052399003676 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.8 | 7.7e-19 | ○○○○○ 1.55 | 1.5476179989125203 | 29101196 |
Retrieved 2 of 2 entries in 2.5 ms
(Link to these results)