Bacterial taxon 1392858
Locus CO715_06570
Protein ATI05408.1
hypothetical protein
Escherichia coli M12
Length 84 aa, Gene n/a, UniProt n/a
>ATI05408.1|Escherichia coli M12|hypothetical protein
MYLHNKNNMSHFCITNKKKQKTSIFIFDQWIFWLIVIIVLLVIIFILPGSHVITLFGGFICWILPFRQVLFSPAYWSVINIDQL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.91 | 2.8e-10 | ●●○○○ -1.94 | -1.9392741912144493 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.13 | 2.1e-7 | ●○○○○ -0.94 | -0.9419462431048922 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)