Bacterial taxon 1392858
Locus CO715_06760
Protein ATI05442.1
hypothetical protein
Escherichia coli M12
Length 122 aa, Gene n/a, UniProt n/a
>ATI05442.1|Escherichia coli M12|hypothetical protein
MNMMRIIYIGLSGVGMMFSSMASGHDAGGLQSPACGVVCDPYICVNSDGISPELTRKYLGEKAAENLQSVQGYDPSEFTFANGVFCDVKEKLCRDDRYFGVDGKRSGKINQTTTKMLFMCRE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.81 | 5.2e-113 | ●●○○○ -1.08 | -1.0827823027228736 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.64 | 0.0029 | ○○○○○ 0.68 | 0.6788159955802621 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)