Bacterial taxon 1392858
Locus CO715_06810
Protein ATI05450.1
hypothetical protein
Escherichia coli M12
Length 109 aa, Gene n/a, UniProt n/a
>ATI05450.1|Escherichia coli M12|hypothetical protein
MKKFALLAGLFVFAPMTWAQDYNIKNGLPSETYITCAEANEMAKTDSAQVAEIVAVMGNASVASRDLKIEQSPELSAKVVEKLNQVCAKDPQMLLITAIDDTMRAIGKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.38 | 1.5e-26 | ●○○○○ -0.99 | -0.9941077466671074 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.34 | 0.00023 | ○○○○○ 0.83 | 0.8250768515687137 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)