Bacterial taxon 1392858
Locus CO715_06920
Protein ATI05470.1
hypothetical protein
Escherichia coli M12
Length 97 aa, Gene n/a, UniProt n/a
>ATI05470.1|Escherichia coli M12|hypothetical protein
MDISPLLHALCAVAAQILVGLFTGNWAYGAIAGCTFFIAREHTQAEYRWIEMFGHGKRMNMPWWGGFDPRAWDVASLMDFAVPVVACLLVWLLVNRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.11 | 4.5e-5 | ○○○○○ 0.31 | 0.3138941166590037 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.83 | 2.6e-12 | ○○○○○ 0.93 | 0.926896106522158 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)