Bacterial taxon 1392858
Locus CO715_06925
Protein ATI05471.1
hypothetical protein
Escherichia coli M12
Length 92 aa, Gene n/a, UniProt n/a
>ATI05471.1|Escherichia coli M12|hypothetical protein
MKDLTLKFPGNREFKSFLSSLDWEEDEDLQNKLLVDEIGFTYTETGVTEEGEPVCVRNDGYFVNIRILDDLFDVSVFSDYVVELETPLREWS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.42 | 0.00015 | ○○○○○ 1.05 | 1.051666423042977 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.87 | 2.8e-6 | ○○○○○ 1.14 | 1.1440966073552226 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)