Bacterial taxon 1392858
Locus CO715_07110
Protein ATI05505.1
hypothetical protein
Escherichia coli M12
Length 63 aa, Gene n/a, UniProt n/a
>ATI05505.1|Escherichia coli M12|hypothetical protein
MHKASPVELRTSIEMAHSLAQIGVRFVPIPAETDEEFHTLAASLSQKLEMMAAKAEANERELA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.97 | 1.3e-9 | ●○○○○ -0.07 | -0.07439611585812717 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.9 | 5.5e-5 | ○○○○○ 0.15 | 0.14906376540240326 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)