Bacterial taxon 1392858
Locus CO715_07455
Protein ATI05564.1
hypothetical protein
Escherichia coli M12
Length 187 aa, Gene n/a, UniProt n/a
>ATI05564.1|Escherichia coli M12|hypothetical protein
MKKWLVTIAALWLAGCSSGEINKNYYQLPVVQSGTQSTASQGNRLLWVEQVAVPDYLAGNGVVYQTSDVKYVIANNNLWASPLDQQLRNTLVANLSTQLPGWVVASQPLGSAQDTLNVTVTEFNGRYDGKVIVSGEWLLNHQGQLIKRPFRLEGVQTQDGYDEMVKVLASVWSQEAASIAQEIKRLP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.07 | 2.4e-7 | ●○○○○ -0.3 | -0.30202891740363486 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.21 | 0.0079 | ○○○○○ 0.08 | 0.08417485497100743 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)