Bacterial taxon 1392858   Locus CO715_07905   Protein ATI05641.1

hypothetical protein

Escherichia coli M12

Length 120 aa, Gene n/a, UniProt n/a

>ATI05641.1|Escherichia coli M12|hypothetical protein
MRMNVFEMEGFLRGKCVPRDLKVNETNAEYLLRKFDALEAKCAALENKIIPVSAELPPANESVLLFDANGEGWLIGWRSLWYTWGQKETGEWQWTFQVGDLENVNITHWAVMPKAPEAGA
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-10.316.9e-16●●○○○ -1.6-1.604814630373524229101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study-6.042.5e-13●○○○○ -0.71-0.714730733587882429101196
Retrieved 2 of 2 entries in 1.3 ms (Link to these results)