Bacterial taxon 1392858
Locus CO715_08090
Protein ATI08766.1
hypothetical protein
Escherichia coli M12
Length 182 aa, Gene n/a, UniProt n/a
>ATI08766.1|Escherichia coli M12|hypothetical protein
MDKFDANRRKLLALGGVALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.32 | 2.7e-6 | ●●○○○ -1.61 | -1.6064837984875153 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.9 | 1.5e-5 | ●●○○○ -1.52 | -1.5188524725029937 | 29101196 |
Retrieved 2 of 2 entries in 15.7 ms
(Link to these results)