Bacterial taxon 1392858
Locus CO715_08525
Protein ATI05754.1
hypothetical protein
Escherichia coli M12
Length 95 aa, Gene n/a, UniProt n/a
>ATI05754.1|Escherichia coli M12|hypothetical protein
MRAIGKLPKSVLILEFIGMMLLAVALLSVSGSLSLPEPFSRPEVQILMIFLGVLLMLPAAVVVILQVAKRLAPQLMNRPPQYSRSEREKDNDANH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.8 | 0.0031 | ○○○○○ 0.17 | 0.17076295088428486 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.21 | 0.036 | ○○○○○ 0.29 | 0.2946986833481084 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)