Bacterial taxon 1392858   Locus CO715_08560   Protein ATI05761.1

hypothetical protein

Escherichia coli M12

Length 94 aa, Gene n/a, UniProt n/a

>ATI05761.1|Escherichia coli M12|hypothetical protein
MIMKNCLLLGALLMGFTGVAMAQSVTVDVPSGYKVVVVPDSVSVPQAVSVATVPQTVYVAPAPAPAYRPHPYVRHLASVGEGMVIEHQIDDHHH
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study0,930,028○○○○○ 0,740.74057521579792529101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study0,880,055○○○○○ 0,730.729725623056984229101196
Retrieved 2 of 2 entries in 0,9 ms (Link to these results)