Bacterial taxon 1392858
Locus CO715_09525
Protein ATI05931.1
hypothetical protein
Escherichia coli M12
Length 87 aa, Gene n/a, UniProt n/a
>ATI05931.1|Escherichia coli M12|hypothetical protein
MLRFMTALMGALLLMQSAFADTVKPEIGKYVFGYRGQEGAVVWMMRIGPKASNEALIQVSHVDNDIDGHIFRCKVKALQEGENPIPP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.76 | 5.1e-6 | ●●○○○ -1.49 | -1.4894333844939043 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.34 | 2.8e-5 | ●●○○○ -1.4 | -1.4020107045236312 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)