Bacterial taxon 1392858
Locus CO715_11065
Protein ATI06193.1
hypothetical protein
Escherichia coli M12
Length 178 aa, Gene n/a, UniProt n/a
>ATI06193.1|Escherichia coli M12|hypothetical protein
MTYQQAGRIAVLKRILGWVIFIPALISTLISLLKFMNTRQENQEGINAVMLDFTHVMIDMMQANTPFLNLFWYNSPTPNFNGGVNVMFWVIFILIFVGLALQDSGARMSRQARFLREGVEDQLILEKAKGEEGLTREQIESRIVVPHHTIFLQFFSLYILPVICIAAGYVFFSLLGFI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.53 | 1.2e-49 | ●○○○○ -0.61 | -0.6070693902354699 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.97 | 0.0024 | ○○○○○ 0.75 | 0.7478778262966351 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)