Bacterial taxon 1392858
Locus CO715_11390
Protein ATI06255.1
hypothetical protein
Escherichia coli M12
Length 167 aa, Gene n/a, UniProt n/a
>ATI06255.1|Escherichia coli M12|hypothetical protein
MTEMAKGSVTHQRLIALLSQEGADFRVVTHEAVGKCEAVSEIRGTALGQGAKALVCKVKGNGVNQHVLAILAADQQADLSQLASHIGGLRASLASPAEVDELTGCVFGAIPPFSFHPKLKLVADPLLFERFDEIAFNAGMLDKSVILKTADYLRIAQPELVNFRRTA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.39 | 2.4e-8 | ●●○○○ -1.41 | -1.4126516512503233 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.04 | 0.00025 | ●○○○○ -0.5 | -0.5048328432535278 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)