Bacterial taxon 1392858
Locus CO715_11420
Protein ATI06261.1
hypothetical protein
Escherichia coli M12
Length 84 aa, Gene n/a, UniProt n/a
>ATI06261.1|Escherichia coli M12|hypothetical protein
MKIISFVLPCLLVLAGCSTPSQPEAPKPPQIGMANPASVYCQQKGGTLIPVQTTQGVSNNCKLPGGETIDEWALWRRDHPAGEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.12 | 0.00037 | ●●○○○ -1.57 | -1.5655891796947385 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.33 | 0.0051 | ●●○○○ -1.19 | -1.1927387522320234 | 29101196 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)