Bacterial taxon 1392858
Locus CO715_11495
Protein ATI06274.1
hypothetical protein
Escherichia coli M12
Length 193 aa, Gene n/a, UniProt n/a
>ATI06274.1|Escherichia coli M12|hypothetical protein
MAVQKNVIKGILAGTFALMLSGCVTVPDAIKGSSPTPQQDLVRVMSAPQLYVGQEARFGGKVVAVQNQQGKTRLEIATVPLDSGARPTLGEPSRGRIYADVNGFLDPVDFRGQLVTVVGPITGAVDGKIGNTPYKFMVMQVTGYKRWHLTQQVIMPPQPIDPWFYGGRGWPYGYGGWGWYNPGPARVQTVVTE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.47 | 0.00074 | ●●○○○ -1.64 | -1.6373634085963469 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.39 | 0.0014 | ●●○○○ -1.41 | -1.4136948813215677 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)