Bacterial taxon 1392858
Locus CO715_11585
Protein ATI06290.1
hypothetical protein
Escherichia coli M12
Length 206 aa, Gene n/a, UniProt n/a
>ATI06290.1|Escherichia coli M12|hypothetical protein
MFAGGDDVFYGYPGQDVVMNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQILWTHFHG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.98 | 9.5e-10 | ●●○○○ -1.74 | -1.7448161059345104 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.01 | 8.8e-8 | ●●○○○ -1.12 | -1.124302859558397 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)