Bacterial taxon 1392858
Locus CO715_11690
Protein ATI06308.1
hypothetical protein
Escherichia coli M12
Length 209 aa, Gene n/a, UniProt n/a
>ATI06308.1|Escherichia coli M12|hypothetical protein
MILFADYNTPYLFAISFVLLIGLLEIFALICGHMLSGALDAHLDHYDSITTGHISQALHYLNIGRLPALVVLCLLAGFFGLIGILLQHTCIMVWQSPLSNLFVVPVSLLFTIIAVHYTGKIVAPWIPRDHSSAITEEEYIGSMALITGHQATSGNPCEGKLTDQFGQIHYLLLEPEEGKIFTKGDKVLIICRLSATRYLAENNPWPQIL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.59 | 3.9e-7 | ○○○○○ 0.21 | 0.21499590590504344 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.79 | 0.0045 | ○○○○○ 0.38 | 0.3804521952043904 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)