Bacterial taxon 1392858
Locus CO715_11935
Protein ATI06354.1
hypothetical protein
Escherichia coli M12
Length 95 aa, Gene n/a, UniProt n/a
>ATI06354.1|Escherichia coli M12|hypothetical protein
MNNHFGKGLMAGLKATHADSAVNVTKFCADYKRGFVLGYSHRMYEKTGDRQLSAWEAGILTRRYGLDKEMVMDFFRENNSCSTLRFFMAGYRLEN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.96 | 7.4e-13 | ●○○○○ -0.07 | -0.07084913361589645 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.48 | 5.5e-9 | ○○○○○ 0.03 | 0.02888366119505917 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)