Bacterial taxon 1392858
Locus CO715_12270
Protein ATI06415.1
hypothetical protein
Escherichia coli M12
Length 78 aa, Gene n/a, UniProt n/a
>ATI06415.1|Escherichia coli M12|hypothetical protein
MMSDTTHSRPEVVSGHTDVIYSTSVCHILAVRKSILLQIDTLIRQLAEISVLTESIGGKTGLNWSRKQGFRCGCWLIE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.56 | 4.5e-12 | ○○○○○ 1.5 | 1.4975429554927935 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 7.58 | 1.3e-29 | ○○○○○ 2.13 | 2.12661068845311 | 29101196 |
Retrieved 2 of 2 entries in 7 ms
(Link to these results)