Bacterial taxon 1392858
Locus CO715_12615
Protein ATI06474.1
hypothetical protein
Escherichia coli M12
Length 179 aa, Gene n/a, UniProt n/a
>ATI06474.1|Escherichia coli M12|hypothetical protein
MKGFPIAHIFHPSIPPMHAVVNNHNRNIDYWTVKRKFAEIVSTNDVNKIYSISNELRRVLSAITALNFYQGDVPSVMIRIQPENMSPFIIDISTGEHDDYIIQTLDVGTFAPFGEQCTCSAVNKKELECIKETISKYCAKFTRKEAILTPPTYFNKTSIPSDCWQILFFSPDHFNNDFY
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.24 | 9.7e-6 | ○○○○○ 0.08 | 0.07895870461478592 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.41 | 0.014 | ○○○○○ 0.63 | 0.6318706423742683 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)