Bacterial taxon 1392858
Locus CO715_12765
Protein ATI06502.1
hypothetical protein
Escherichia coli M12
Length 211 aa, Gene n/a, UniProt n/a
>ATI06502.1|Escherichia coli M12|hypothetical protein
MSQVLITGATGLVGGHLLRMLINEPKVNAIAAPTRRPLGDMPGVFNPHDPQLTDALAQVTDPIDIVFCCLGTTRREAGSKEAFIHADYTLVVDTALTGRRLGAQHMLVVSAMGAKAHSPFFYNRVKGEMEEALIAQNWPKLTIARPSMLLGDRSKQRMNETLFAPLFRLLPGNWKSIDARDVARVMLAEAMRPEHEGVTILSSSELRKRAE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.9 | 3.0e-9 | ●●○○○ -1.52 | -1.5184351804744958 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.03 | 0.02 | ○○○○○ 0.12 | 0.12319165963554446 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)