Bacterial taxon 1392858
Locus CO715_12775
Protein ATI06504.1
hypothetical protein
Escherichia coli M12
Length 147 aa, Gene n/a, UniProt n/a
>ATI06504.1|Escherichia coli M12|hypothetical protein
METLTAISRWLAKQHVVTWCVQQEGELWCANAFYLFDAQKVAFYILTEEKTRHAQMSGPQAAVAGTVNGQPKTVALIRGVQFKGEIRRLEGEESDLARKAYNRRFPVARMLSAPVWEIRLDEIKFTDNTLGFGKKMIWLRNSGTEQA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.44 | 3.9e-15 | ●●○○○ -1.84 | -1.840375980460489 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.07 | 4.8e-19 | ○○○○○ 1.19 | 1.1870776862904882 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)