Bacterial taxon 1392858
Locus CO715_12780
Protein ATI06505.1
hypothetical protein
Escherichia coli M12
Length 100 aa, Gene n/a, UniProt n/a
>ATI06505.1|Escherichia coli M12|hypothetical protein
MTPWFLYLIRTADNKLYTGITTDVERRYQQHQSGKGAKALRGKGELTLAFSAPVGDRSLALRAEYRVKQLTKRQKERLVAEGAGFAELLSSLQTPKVKSD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.4 | 1.4e-7 | ●●○○○ -1.83 | -1.8324474319190323 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.53 | 1.7e-5 | ●●○○○ -1.23 | -1.2344679550817959 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)