Bacterial taxon 1392858
Locus CO715_12810
Protein ATI06511.1
hypothetical protein
Escherichia coli M12
Length 239 aa, Gene n/a, UniProt n/a
>ATI06511.1|Escherichia coli M12|hypothetical protein
MGRKGLLAIVLLSLFIAMIFQFFWPAPHDEHVFLPVEKPVAPSLKIIHPGDQLFIRILKAEDKLELWASTNNKPYELYKTRTICAWSGGLGPKHKQGDGKSPEGFYATNKELLNPNSRYHLAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNSGQKSVPVHIFPFAMDEENMRQAQVWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKISPTTLP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.54 | 6.5e-8 | ○○○○○ 0.23 | 0.22542820661748653 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.79 | 0.0041 | ○○○○○ 0.71 | 0.710530189746089 | 29101196 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)