Bacterial taxon 1392858
Locus CO715_13445
Protein ATI06623.1
hypothetical protein
Escherichia coli M12
Length 47 aa, Gene n/a, UniProt n/a
>ATI06623.1|Escherichia coli M12|hypothetical protein
MSLDPLACGHDNVKQSKIVALTVSLGDKKAQYSRWQPDNLTVDAETK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.87 | 2.6e-9 | ○○○○○ 0.36 | 0.36459509812147695 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.75 | 5.6e-7 | ○○○○○ 0.7 | 0.7034362252616276 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)