Bacterial taxon 1392858
Locus CO715_13500
Protein ATI06631.1
hypothetical protein
Escherichia coli M12
Length 99 aa, Gene n/a, UniProt n/a
>ATI06631.1|Escherichia coli M12|hypothetical protein
MALTIKLRWRYIEPPPMTGALADLKVWVMDTGEPELEAEFRMLLGLMRRNGISDEHVNAMAVELYALVCQRQREEYEACKRAASDSGDFESWLHGQTDY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.15 | 1.1e-54 | ●○○○○ -0.11 | -0.1117437524086733 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.28 | 3.3e-20 | ○○○○○ 1.02 | 1.0207868129341457 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)