Bacterial taxon 1392858
Locus CO715_13920
Protein ATI06707.1
hypothetical protein
Escherichia coli M12
Length 212 aa, Gene n/a, UniProt n/a
>ATI06707.1|Escherichia coli M12|hypothetical protein
MPGRFELKPTLEKVWHAPDNFRFMDPLPPMHRRGIIIAAIVLVVGFLLPSDDTPNAPVVTREAQLDIQSQSQPPTEEQLRAQLVTPQNDPDQVAPVAPEPIQEGQPEEQPQTTQTQPFQPDSGIDNQWRSYRVEPGKTMAQLFRDHGLPATDVYAMAQVEGAGKPLSNLQNGQMVKIRQNASGVVTGLTIDTGNNQQVLFTRQPDGSFIRAR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.26 | 5.5e-47 | ○○○○○ 1.23 | 1.2258858449407761 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.83 | 1.3e-62 | ○○○○○ 1.34 | 1.3441881350198805 | 29101196 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)