Bacterial taxon 1392858
Locus CO715_14130
Protein ATI06744.1
hypothetical protein
Escherichia coli M12
Length 128 aa, Gene n/a, UniProt n/a
>ATI06744.1|Escherichia coli M12|hypothetical protein
MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKSVKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDLRHLESVVTNKISEIEADLEKLTRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.17 | 2.6e-5 | ●○○○○ -0.32 | -0.3245626869425118 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.74 | 2.4e-6 | ○○○○○ 1.33 | 1.3260359317802295 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)