Bacterial taxon 1392858
Locus CO715_14880
Protein ATI06884.1
hypothetical protein
Escherichia coli M12
Length 91 aa, Gene n/a, UniProt n/a
>ATI06884.1|Escherichia coli M12|hypothetical protein
MKIISKMLVGALAFAVTNVYAAELMTKAEFEKVESQYEKIGDISTSNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTANIYKKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.13 | 6.1e-7 | ●○○○○ -0.73 | -0.7337175208845288 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.39 | 6.9e-12 | ○○○○○ 1.46 | 1.462281779084736 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)