Bacterial taxon 1392858
Locus CO715_15185
Protein ATI06939.1
hypothetical protein
Escherichia coli M12
Length 79 aa, Gene n/a, UniProt n/a
>ATI06939.1|Escherichia coli M12|hypothetical protein
MSNQGEYPEDNRVGKHEPHDFSLTRRDLIKVSAATAATAVVYPHSTLAASVPAATPAPEIMPLTLKVCSGQVILATVLQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.95 | 0.021 | ●○○○○ -0.07 | -0.07001454955890102 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.47 | 0.033 | ○○○○○ 1.06 | 1.0618900777411713 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)