Bacterial taxon 1392858
Locus CO715_15315
Protein ATI06962.1
hypothetical protein
Escherichia coli M12
Length 84 aa, Gene n/a, UniProt n/a
>ATI06962.1|Escherichia coli M12|hypothetical protein
MLLVSTLSRPIYIRLLRVQGVGVIFLCGRGRKGPELAQFPSIQEGFVTEYHNVGVCVLIWLRESEKNTAKRNRKCDKYHRCSSN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.66 | 2.5e-9 | ●●○○○ -1.47 | -1.4689860750975157 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.2 | 5.2e-5 | ●○○○○ -0.12 | -0.12134146906412088 | 29101196 |
Retrieved 2 of 2 entries in 12.3 ms
(Link to these results)