Bacterial taxon 1392858
Locus CO715_16100
Protein ATI07099.1
hypothetical protein
Escherichia coli M12
Length 115 aa, Gene n/a, UniProt n/a
>ATI07099.1|Escherichia coli M12|hypothetical protein
MKTFFRTVLFGSLMAVCANSYALSESEAEDMADLTAVFVFLKNDCGYQNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALARDSLSLLAYVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.43 | 2.2e-5 | ●●○○○ -1.63 | -1.6300607980976367 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.01 | 9.5e-5 | ●●○○○ -1.54 | -1.5424294721131149 | 29101196 |
Retrieved 2 of 2 entries in 5.8 ms
(Link to these results)