Bacterial taxon 1392858
Locus CO715_16400
Protein ATI07156.1
hypothetical protein
Escherichia coli M12
Length 254 aa, Gene n/a, UniProt n/a
>ATI07156.1|Escherichia coli M12|hypothetical protein
MQALLEHFITQSTVYSLIAVVLVAFLESLALVGLILPGTVLMAGLGALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHALHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAGAAIDIPAGMQSGEFKWLLLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTPLISAVGVVALVVLIRHPLMPIYIDILRKVVGG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.31 | 1.6e-5 | ●○○○○ -0.77 | -0.7706478654065771 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.91 | 2.6e-5 | ○○○○○ 1.57 | 1.5714036445368904 | 29101196 |
Retrieved 2 of 2 entries in 2.4 ms
(Link to these results)