Bacterial taxon 1392858
Locus CO715_17500
Protein ATI07355.1
hypothetical protein
Escherichia coli M12
Length 135 aa, Gene n/a, UniProt n/a
>ATI07355.1|Escherichia coli M12|hypothetical protein
MNREKGVSSLALVLMLLILGSLLLQGMSQQDRSFASRVSMESQSLRRQAIVQSALEWGKMHSWQTQPAVQCLLYAATGARVCLRLLADNEALLIAGYEGVSLWRTGEVIDGNIVFSPRGWSDFCPLKERALCQLP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.37 | 0.0066 | ○○○○○ 0.26 | 0.2604807370112952 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.76 | 3.8e-9 | ○○○○○ 1.12 | 1.1217714838305946 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)