Bacterial taxon 1392858
Locus CO715_17665
Protein ATI07385.1
hypothetical protein
Escherichia coli M12
Length 72 aa, Gene n/a, UniProt n/a
>ATI07385.1|Escherichia coli M12|hypothetical protein
MTNPINMNNFSQSLNIATATGDEVVSLDKHITTSTTDTDQIQAFIVSTWMASFQNDMYSKDNPISPYYELEW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.29 | 7.8e-5 | ●○○○○ -0.98 | -0.9751209593704613 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.28 | 0.00033 | ●○○○○ -0.76 | -0.7639711929506136 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)