Bacterial taxon 1392858
Locus CO715_17925
Protein ATI07430.1
hypothetical protein
Escherichia coli M12
Length 41 aa, Gene n/a, UniProt n/a
>ATI07430.1|Escherichia coli M12|hypothetical protein
MNLLMRAIFSLLLLFTLSIPVISDCVAMAIESRFKYMMLLF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.64 | 1.0e-5 | ●○○○○ -0.84 | -0.8401269881514479 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.62 | 7.8e-20 | ○○○○○ 1.51 | 1.509018486276481 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)