Bacterial taxon 1392858
Locus CO715_18775
Protein ATI07579.1
hypothetical protein
Escherichia coli M12
Length 160 aa, Gene n/a, UniProt n/a
>ATI07579.1|Escherichia coli M12|hypothetical protein
MIKHLVAPLIFTSLILTGCQSPQGKFTPEQVAAMQSYGFTESAGDWSLGLSDAILFAKNDYKLLPESQQQIQTMAAKLASTGLTHARMDGHTDNYGEDSYNEGLSLKRANVVADAWAIGGQIPRSNLTTQGLGKKYPIARNKTAQGRAENRRVAVVITTP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.35 | 0.034 | ●○○○○ -0.57 | -0.5705563377419193 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 5.56 | 0.0035 | ○○○○○ 1.71 | 1.7066062617701527 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)