Bacterial taxon 1392858
Locus CO715_18790
Protein ATI07582.1
hypothetical protein
Escherichia coli M12
Length 121 aa, Gene n/a, UniProt n/a
>ATI07582.1|Escherichia coli M12|hypothetical protein
MMKKFIAPLLALLVSGCQIDPYTHAPTLTSTDWYDVGMEDAISGSAIKDDDAFSDSQADRGLYLKGYAEGQKKTCQTDFTYARGLSGKSFPASCNNVENASQLHEVWRKGADENASTIRLN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.66 | 7.2e-30 | ●○○○○ -0.43 | -0.42638194189595596 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.86 | 3.1e-22 | ●○○○○ -0.26 | -0.2594651304968671 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)