Bacterial taxon 1392858
Locus CO715_19295
Protein ATI07672.1
hypothetical protein
Escherichia coli M12
Length 85 aa, Gene n/a, UniProt n/a
>ATI07672.1|Escherichia coli M12|hypothetical protein
MIMAKLKSAKGKKFLFGLLAVFIIAASVVTRATIGGVIEQYNIPLSEWTTSMYVIQSSMIFVYSLVFTVLLAIPLGIYFLGGEEQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.63 | 8.7e-5 | ●○○○○ -0.21 | -0.21147654721962894 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.86 | 3.5e-10 | ○○○○○ 1.56 | 1.559719467738954 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)