Bacterial taxon 1392858
Locus CO715_19575
Protein ATI07725.1
hypothetical protein
Escherichia coli M12
Length 83 aa, Gene n/a, UniProt n/a
>ATI07725.1|Escherichia coli M12|hypothetical protein
MNKETQPIDRETLLKEANKIIREHEDTLAGIEATGVTQRNGVLVFTGDYFLDEQGLPTAKSTAVFNMFKHLAHVLSEKYHLVD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.05 | 8.8e-13 | ●●○○○ -1.76 | -1.7587953888891843 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.39 | 1.4e-19 | ●●○○○ -1.2 | -1.2042142830157108 | 29101196 |
Retrieved 2 of 2 entries in 2.5 ms
(Link to these results)