Bacterial taxon 1392858
Locus CO715_19645
Protein ATI07737.1
hypothetical protein
Escherichia coli M12
Length 59 aa, Gene n/a, UniProt n/a
>ATI07737.1|Escherichia coli M12|hypothetical protein
MAEHRGGSGNFAEDREKASDAGRKGGQHSGGNFKNDPQRASEAGKKGGQQSGGNKSGKS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.65 | 3.1e-6 | ○○○○○ 0.2 | 0.20247714505011175 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.6 | 2.6e-6 | ○○○○○ 0.21 | 0.21311809177680366 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)