Bacterial taxon 1392858
Locus CO715_20290
Protein ATI07856.1
hypothetical protein
Escherichia coli M12
Length 102 aa, Gene n/a, UniProt n/a
>ATI07856.1|Escherichia coli M12|hypothetical protein
MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLLVHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 6.35 | 3.3e-17 | ○○○○○ 1.87 | 1.8712279670125038 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 7.36 | 0.0012 | ○○○○○ 2.08 | 2.082586379446601 | 29101196 |
Retrieved 2 of 2 entries in 49.4 ms
(Link to these results)