Bacterial taxon 1392858
Locus CO715_20770
Protein ATI07941.1
hypothetical protein
Escherichia coli M12
Length 191 aa, Gene n/a, UniProt n/a
>ATI07941.1|Escherichia coli M12|hypothetical protein
MKKSLLGLTFASLMFSAGSAVAADYKIDKEGQHAFVNFRIQHLGYSWLYGTFKDFDGTFTFDEKNPAADKVNVTINTTSVDTNHAERDKHLRSADFLNTAKYPQATFTSTSVKKDGDDLDITGDLTLNGVTKPVTLEAKLIGQGDDPWGGKRAGFEAEGKIKLKDFNIKTDLGPASQEVDLIISVEGVQQK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.4 | 3.6e-7 | ●○○○○ -0.16 | -0.16307067191389316 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.27 | 0.0012 | ○○○○○ 0.07 | 0.0731166162158178 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)