Bacterial taxon 1392858
Locus CO715_20805
Protein ATI07948.1
hypothetical protein
Escherichia coli M12
Length 186 aa, Gene n/a, UniProt n/a
>ATI07948.1|Escherichia coli M12|hypothetical protein
MNKFLFAAALIVSGLLVGCNQLTQYTITEQEINQSLAKHNNFSKDIGLPGVADAHIVLTNLTSQIGREEPNKVTLTGDANLDMNSLFGSQKATMKLKLKALPVFDKEKGAIFLKEMEVVDATVQPEKMQTVMQTLLPYLNQALRNYFNQQPAYVLHEDGSQGEAMAKKLAKGIEVKPGEIVIPFTD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.44 | 2.5e-13 | ●●○○○ -1.22 | -1.2152725217709006 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.54 | 4.9e-24 | ○○○○○ 1.49 | 1.4929527431793186 | 29101196 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)