Bacterial taxon 1392858
Locus CO715_21100
Protein ATI08004.1
hypothetical protein
Escherichia coli M12
Length 65 aa, Gene n/a, UniProt n/a
>ATI08004.1|Escherichia coli M12|hypothetical protein
MTIAERLRQEGHQIGWQEGKLEGLQEGMHEQAIKIALRMLEQGIDRDLVLAATQLSEADLAANNH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.8 | 0.00012 | ●○○○○ -0.87 | -0.8722584743457726 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.87 | 0.0028 | ●○○○○ -0.26 | -0.2605083605681114 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)